biopython-sequence-analysis
Biopython sequence analysis: parse FASTA/FASTQ/GenBank/GFF (SeqIO), NCBI Entrez (esearch/efetch/elink), remote/local BLAST, pairwise/MSA alignment (PairwiseAligner, MUSCLE/ClustalW), phylogenetic trees (Phylo). Use for gene family studies, phylogenomics, comparative genomics, NCBI pipelines.
Install / Use
npx skills add jaechang-hits/SciAgent-Skills --skill biopython-sequence-analysisInstalls into whichever agent you are using.
SKILL.md
Installable skill definition
Quality Score
Category
AutomationSupported Platforms
Our assessment of biopython-sequence-analysis
biopython-sequence-analysis scores 91/100 on our quality scale, 1093rd of 2,866 Automation skills we index (top 39%).
Its SKILL.md is 33 KB long, well organised into 83 sections with 21 code examples: a thorough specification that gives an agent plenty to work with.
It has 367 GitHub stars, a meaningful sign that others use it.
Maintenance, license and trust
- The repository was last updated 37 days ago, so biopython-sequence-analysis is actively maintained.
- No license is declared. By default that means all rights are reserved: you can read it, but reusing or redistributing it is not clearly permitted. Ask the author before building on it commercially.
- Its trust signals score 88/100, with 1 caution from licensing, adoption, age or documentation. These come from repository metadata, not a code audit — read the skill file before letting an agent act on it.
Safety scan
No issues foundOur scan of the whole file found no instruction hijacking, hidden characters, credential access, data exfiltration or destructive commands.
Automated pattern scan on 2026-10-05. It catches known dangerous patterns, not every risk — read a skill before letting an agent act on it.
biopython-sequence-analysis compared with similar skills
All 4 of these similar skills score higher than biopython-sequence-analysis; compare them before choosing.
| Skill | Score | Stars | Updated | Format |
|---|---|---|---|---|
| biopython-sequence-analysis (this skill)by jaechang-hits | 91 | 367 | 37d ago | SKILL.md |
| Agent-Reachby Panniantong | 100 | 90.8k | 19d ago | CLAUDE.md |
| headroomby headroomlabs-ai | 100 | 74.4k | today | CLAUDE.md |
| Scraplingby D4Vinci | 100 | 85.7k | today | MCP Server |
| crawl4aiby unclecode | 100 | 84.8k | 9d ago | MCP Server |
Frequently asked questions
- How do I install biopython-sequence-analysis?
- Run
npx skills add jaechang-hits/SciAgent-Skills --skill biopython-sequence-analysis. The install tabs above show the steps for each supported agent. - Which AI agents does biopython-sequence-analysis work with?
- It is written for Universal, as a SKILL.md file. Other agents that read the same format can often use it too.
- Is biopython-sequence-analysis safe to use?
- Our scan of the whole file found no instruction hijacking, hidden characters, credential access, data exfiltration or destructive commands. It declares no license and scores 88/100 on trust signals. Skills are instructions an agent will follow, so read the file before installing it and do not approve commands you do not understand.
- Is biopython-sequence-analysis still maintained?
- The repository was last updated 37 days ago, so biopython-sequence-analysis is actively maintained.
Skill content
View source on GitHubname: "biopython-sequence-analysis" description: "Biopython sequence analysis: parse FASTA/FASTQ/GenBank/GFF (SeqIO), NCBI Entrez (esearch/efetch/elink), remote/local BLAST, pairwise/MSA alignment (PairwiseAligner, MUSCLE/ClustalW), phylogenetic trees (Phylo). Use for gene family studies, phylogenomics, comparative genomics, NCBI pipelines. For PCR/restriction/cloning use biopython-molecular-biology; for SAM/BAM use pysam." license: "Biopython License (BSD-like)"
Biopython: Sequence Analysis Toolkit
Overview
Biopython provides a comprehensive suite of modules for sequence-centric bioinformatics: reading and writing every major biological file format (FASTA, FASTQ, GenBank, GFF), querying NCBI databases programmatically, running BLAST searches and parsing results, aligning sequences pairwise or in multiple-sequence alignments, and building and visualizing phylogenetic trees. This skill focuses on analysis workflows — from NCBI data retrieval through alignment to phylogenetic inference.
For PCR primer design, restriction enzyme digestion, cloning simulation, protein structure analysis (Bio.PDB), and molecular weight/Tm calculations, see biopython-molecular-biology.
When to Use
- Download a gene family from NCBI Nucleotide/Protein, align sequences, and construct a phylogenetic tree
- Parse GenBank or GFF3 annotation files and extract CDS sequences for a set of features
- Run a BLAST search against NCBI
ntornr, filter significant hits, and fetch their full sequences - Compute pairwise sequence identities or score alignments with BLOSUM62/PAM250 matrices
- Index a large multi-FASTA or FASTQ file with
SeqIO.index()for random-access retrieval without loading all sequences into RAM - Convert between sequence formats (FASTA ↔ GenBank ↔ FASTQ ↔ PHYLIP) in a single call
- Traverse, root, prune, and annotate a Newick or Nexus phylogenetic tree programmatically
- Use pysam instead when working with SAM/BAM/CRAM alignment files and mapped reads
- Use scikit-bio instead when you need ecological diversity metrics (UniFrac, beta diversity) or ordination methods such as PCoA
- Use gget instead for quick gene lookups and one-liner NCBI queries without writing an Entrez pipeline
Prerequisites
- Python packages:
biopython,numpy,matplotlib - Optional tools: MUSCLE or ClustalW installed locally (for
Bio.Align.Applicationswrappers) - NCBI access: Set
Entrez.emailbefore any E-utilities call; obtain a free API key at https://www.ncbi.nlm.nih.gov/account/ for 10 req/s (default is 3 req/s) - Local BLAST: BLAST+ installed separately (
conda install -c bioconda blast) for offline searches
Check before installing: The tool may already be available in the current environment (e.g., inside a
pixi/condaenv). Runcommand -v pythonfirst and skip the install commands below if it returns a path. When running inside a pixi project, invoke the tool viapixi run pythonrather than barepython.
pip install biopython numpy matplotlib
conda install -c bioconda blast # optional, for local BLAST
Quick Start
from Bio import SeqIO, Entrez
from Bio.SeqUtils import gc_fraction
# Fetch a GenBank record and display basic stats
Entrez.email = "your.email@example.com"
handle = Entrez.efetch(db="nucleotide", id="NM_007294", rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f"ID: {record.id}")
print(f"Length: {len(record.seq)} bp")
print(f"GC content: {gc_fraction(record.seq)*100:.1f}%")
print(f"Features: {len(record.features)}")
print(f"First feature: {record.features[0].type} at {record.features[0].location}")
# ID: NM_007294.4
# Length: 7207 bp
# GC content: 47.3%
# Features: 9
Core API
Module 1: SeqIO — File Parsing and Format Conversion
Bio.SeqIO reads and writes every major sequence format (FASTA, FASTQ, GenBank, EMBL, PHYLIP, Nexus). SeqIO.parse() returns an iterator of SeqRecord objects; SeqIO.index() builds an on-disk or in-memory dictionary for large files.
from Bio import SeqIO
# Parse FASTA and FASTQ
fasta_records = list(SeqIO.parse("sequences.fasta", "fasta"))
print(f"FASTA: {len(fasta_records)} sequences")
# FASTQ: access quality scores
for rec in SeqIO.parse("reads.fastq", "fastq"):
quals = rec.letter_annotations["phred_quality"]
avg_q = sum(quals) / len(quals)
print(f" {rec.id}: {len(rec.seq)} bp, mean Q={avg_q:.1f}")
break # show one example
# Parse GenBank with feature access
for rec in SeqIO.parse("chromosome.gb", "genbank"):
cdss = [f for f in rec.features if f.type == "CDS"]
print(f"{rec.id}: {len(cdss)} CDS features")
for cds in cdss[:3]:
gene = cds.qualifiers.get("gene", ["unknown"])[0]
print(f" {gene}: {cds.location}")
from Bio import SeqIO
# SeqIO.index() for random access without loading all records
# Useful for large reference FASTA files (genomes, nr database subsets)
idx = SeqIO.index("large_genome.fasta", "fasta")
print(f"Index contains {len(idx)} sequences")
# Retrieve specific sequences by ID in O(1)
target = idx["chr1"]
print(f"chr1: {len(target.seq):,} bp")
region = target.seq[1_000_000:1_001_000]
print(f"Region [1M-1M+1kb]: {region[:60]}...")
# Format conversion: GenBank → FASTA in one call
n = SeqIO.convert("annotation.gb", "genbank", "sequences.fasta", "fasta")
print(f"Converted {n} records to FASTA")
Module 2: Seq and SeqRecord — Sequence Objects and Feature Annotations
Bio.Seq represents a biological sequence with in-place operations. Bio.SeqRecord wraps a Seq with an ID, description, and a dictionary of feature annotations. Features use FeatureLocation with strand (+1, -1).
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.SeqFeature import SeqFeature, FeatureLocation
from Bio.SeqUtils import gc_fraction, MeltingTemp
dna = Seq("ATGAAACCCGGGTTTTAA")
print(f"GC content: {gc_fraction(dna)*100:.1f}%")
print(f"Reverse complement: {dna.reverse_complement()}")
print(f"Transcript: {dna.transcribe()}")
print(f"Translation: {dna.translate()}")
print(f"Translation (to stop): {dna.translate(to_stop=True)}")
# Tm calculation for a short primer
primer = Seq("ATGAAACCCGGG")
tm = MeltingTemp.Tm_Wallace(primer)
print(f"Tm (Wallace): {tm:.1f}°C")
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.SeqFeature import SeqFeature, FeatureLocation
# Build a SeqRecord with annotated features
gene_seq = Seq("ATGAAACCCGGGTTTTAAATCGATCG" * 10)
record = SeqRecord(gene_seq, id="MY_GENE_001", description="synthetic example gene")
# Annotate a CDS feature
cds = SeqFeature(
FeatureLocation(0, 18, strand=+1),
type="CDS",
qualifiers={"gene": ["myGene"], "product": ["hypothetical protein"]}
)
record.features.append(cds)
# Extract and translate the feature
cds_seq = cds.location.extract(record.seq)
protein = cds_seq.translate(to_stop=True)
print(f"CDS: {cds_seq}")
print(f"Protein: {protein}")
# Slice record preserving feature annotations
sub = record[0:60]
print(f"Subrecord: {len(sub.seq)} bp, {len(sub.features)} features")
Module 3: Entrez — Programmatic NCBI Database Access
Bio.Entrez wraps the NCBI E-utilities API: esearch finds records matching a query, efetch retrieves full records, elink finds related records across databases, and esummary returns document summaries. Always set Entrez.email and respect the 3 req/s rate limit (10 req/s with API key).
from Bio import Entrez, SeqIO
import time
Entrez.email = "your.email@example.com"
# Entrez.api_key = "YOUR_API_KEY" # for 10 req/s
# esearch: find IDs matching a query
handle = Entrez.esearch(db="nucleotide", term="BRCA1[Gene] AND Homo sapiens[Organism] AND mRNA[Filter]", retmax=10)
search_results = Entrez.read(handle)
handle.close()
print(f"Total hits: {search_results['Count']}")
ids = search_results["IdList"]
print(f"Retrieved IDs: {ids}")
# efetch: download full GenBank records
for acc_id in ids[:3]:
handle = Entrez.efetch(db="nucleotide", id=acc_id, rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f" {record.id}: {len(record.seq)} bp — {record.description[:60]}")
time.sleep(0.4) # stay within rate limit
from Bio import Entrez
import time
Entrez.email = "your.email@example.com"
# elink: cross-database links (e.g., PubMed article → related nucleotide sequences)
handle = Entrez.elink(dbfrom="pubmed", db="nucleotide", id="29087512")
link_results = Entrez.read(handle)
handle.close()
linked_ids = []
for linkset in link_results:
for db_links in linkset.get("LinkSetDb", []):
if db_links["DbTo"] == "nucleotide":
linked_ids = [lnk["Id"] for lnk in db_links["Link"]]
break
print(f"Nucleotide sequences linked to PubMed 29087512: {len(linked_ids)}")
print(f"First IDs: {linked_ids[:5]}")
# esummary: lightweight metadata without downloading full records
if linked_ids:
handle = Entrez.esummary(db="nucleotide", id=",".join(linked_ids[:5]))
summaries = Entrez.read(handle)
handle.close()
for doc in summaries:
print(f" {doc['AccessionVersion']}: {doc['Title'][:70]}")
Module 4: BLAST — Remote and Local Sequence Similarity Search
Bio.Blast.NCBIWWW.qblast() submits queries to NCBI BLAST servers and returns XML handles. Bio.Blast.NCBIXML.parse() (or .read() for single queries) yields Blast objects with alignments and hsps. For large-scale searches, use local BLAST+ via subprocess.
from Bio.Blast import NCBIWWW, NCBIXML
from Bio.Seq import Seq
# Remote BLASTP against Swiss-Prot (small, reviewed database)
query = Seq("MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSY")
result_handle = NCBIWWW.qblast("blastp", "swissprot", str(query), hitlist_size=10)
# Parse results
blast_record = NCBIXML.read(result_handle)
print(f"Query: {blast_record.query}")
print(f"Database: {blast_record.database}")
print(f"Hits: {len(blast_record.alignments)}")
E_VALUE_THRESH = 1e-5
for alignment in blast_record.alignments[:5]:
for hsp in alignment.hsps:
if hsp.expect < E_VALUE_THRESH:
identity_pct = hsp.identities / hsp.align_length * 100
print(f"\n Hit: {alignment.title[:70]}")
print(f" E-value: {hsp.expect:.2e}, Identity: {identity_pct:.1f}%, Score: {hsp.score}")
print(f" Query: {hsp.query[:60]}")
print(f" Match: {hsp.match[:60]}")
print(f" Sbjct: {hsp.sbjct[:60]}")
import subprocess
from Bio.Blast import NCBIXML
from Bio import SeqIO
# Local BLAST+ via subprocess (faster for large batches)
# Requires: makeblastdb and blastp installed (conda install -c bioconda blast)
# Step 1: Build a local database from a FASTA file
subprocess.run(
["makeblastdb", "-in", "ref_proteins.fasta", "-dbtype", "prot", "-out", "ref_db"],
check=True
)
# Step 2: Run blastp against local database
result = subprocess.run(
["blastp", "-query", "query.fasta", "-db", "ref_db",
"-outfmt", "5", # XML output for NCBIXML parsing
"-evalue", "1e-5",
"-num_threads", "4",
"-out", "blast_results.xml"],
check=True
)
# Step 3: Parse XML results
with open("blast_results.xml") as fh:
for blast_rec in NCBIXML.parse(fh):
print(f"Query: {blast_rec.query_id}")
for aln in blast_rec.alignments[:3]:
hsp = aln.hsps[0]
print(f" Hit: {aln.hit_id}, E={hsp.expect:.2e}, Id={hsp.identities}/{hsp.align_length}")
Module 5: Phylo — Tree Parsing, Manipulation, and Visualization
Bio.Phylo reads Newick, Nexus, PhyloXML, and NeXML formats. Trees are represented as Clade objects with nested children. Key methods: find_clades() (generator over nodes), common_ancestor(), distance(), root_with_outgroup(), and prune(). Visualization uses matplotlib.
from Bio import Phylo
import
Truncated for display — read the full file on GitHub.
Related Skills
Agent-Reach
90.8kGive your AI agent eyes to see the entire internet. Read & search Twitter, Reddit, YouTube, GitHub, Bilibili, XiaoHongShu — one CLI, zero API fees.
headroom
74.4kCompress tool outputs, logs, files, and RAG chunks before they reach the LLM. 20% fewer tokens for coding agents, 60-95% fewer tokens for JSON, same answers. Library, proxy, MCP server.
Scrapling
85.7k🕷️ An adaptive Web Scraping framework that handles everything from a single request to a full-scale crawl! Don't be shy, join here: https://discord.gg/EMgGbDceNQ and follow here for daily tips and tricks: https://x.com/Scrapling_dev
crawl4ai
84.8kOpen-source web crawler and scraper for LLMs and AI agents: any website into clean, LLM-ready Markdown. Run it yourself, or use Crawl4AI Cloud with one key.
Languages
Trust signals
From repository metadata: license, adoption, age and documentation. Not a code audit — see the Safety scan above for what the skill file itself contains.
